PT000526
Amylin(34-71)-Synthetic Analogue
Pramlintide is a synthetic analogue of the naturally occurring neuroendocrine hormone Amylin, currently used for type I and type II diabetes patients. Amylin is also known as islet amyloid polypeptide (IAPP). Amylin (UniProt ID P10997) synthetic peptide analogue fragment (Lys34-Tyr71; UniProt position 34-71; aa length 37). The C-terminus is an amide.
Sequence:
K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2
H-Lys-(Cys-Asn-Thr-Ala-Thr-Cys)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Amylin(34-71)-Synthetic Analogue
Pramlintide is a synthetic analogue of the naturally occurring neuroendocrine hormone Amylin, currently used for type I and type II diabetes patients. Amylin is also known as islet amyloid polypeptide (IAPP). Amylin (UniProt ID P10997) synthetic peptide analogue fragment (Lys34-Tyr71; UniProt position 34-71; aa length 37). The C-terminus is an amide.
Sequence:
K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2
H-Lys-(Cys-Asn-Thr-Ala-Thr-Cys)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Inquire for price
Couldn't load pickup availability
For research and development use only
-
Other Names
Formerly GP200100
-
Technical Data
UniProt ID: P10997
Formula: C177H278N52O54S2
Molecular Weight: 4062.55
Purity: >90% (HPLC)
-
Storage & Shipping
Shipping requirement: Dry Ice
Storage conditions: -20°C