PT000526

Amylin(34-71)-Synthetic Analogue

Pramlintide is a synthetic analogue of the naturally occurring neuroendocrine hormone Amylin, currently used for type I and type II diabetes patients. Amylin is also known as islet amyloid polypeptide (IAPP). Amylin (UniProt ID P10997) synthetic peptide analogue fragment (Lys34-Tyr71; UniProt position 34-71; aa length 37). The C-terminus is an amide.


Sequence:

K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2
H-Lys-(Cys-Asn-Thr-Ala-Thr-Cys)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Amylin(34-71)-Synthetic Analogue

Pramlintide is a synthetic analogue of the naturally occurring neuroendocrine hormone Amylin, currently used for type I and type II diabetes patients. Amylin is also known as islet amyloid polypeptide (IAPP). Amylin (UniProt ID P10997) synthetic peptide analogue fragment (Lys34-Tyr71; UniProt position 34-71; aa length 37). The C-terminus is an amide.


Sequence:

K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2
H-Lys-(Cys-Asn-Thr-Ala-Thr-Cys)-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2

Skip to product information
1 of 0
Regular price Price
Inquire for price
Regular price Sale price $0.00 USD
In Stock Add to cart
Inquire
  • For research and development use only
View full details
  • Other Names

    Formerly GP200100

  • Technical Data

    UniProt ID: P10997

    Formula: C177H278N52O54S2

    Molecular Weight: 4062.55

    Purity: >90% (HPLC)

  • Storage & Shipping

    Shipping requirement: Dry Ice

    Storage conditions: -20°C

1 of 3