Collection: Amylin
Amylin glycopeptides are modified forms of the natural peptide hormone amylin, which plays a major role in glucose homeostasis and appetite regulation. Amylin glycopeptides are designed to enhance the stability and effectiveness of amylin in therapeutic applications. In terms of therapeutic application, amylin glycopeptides are primarily used to complement insulin therapy in managing diabetes, particularly type 1 and type 2 diabetes. These modified peptides help control postprandial blood glucose levels by slowing gastric emptying and reducing glucose absorption. Additionally, they assist in weight management by promoting satiety. Biomedical use of amylin glycopeptides extends to improving patient outcomes by addressing the limitations of traditional insulin therapy, offering a more comprehensive approach to managing glucose levels and associated metabolic conditions.
-
K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTN*VGSNTY-NH2
Where N* = Asn* = GlcNAcβ-AsnIn Stock -
K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTN*VGSNTY-NH2
Where N* = Asn* = GlcNAcβ-AsnInquire -
K(CNTATC)ATQRLANFLVHSSNNFGPILLPPTNVGSNTY-NH2Inquire
Interested in Custom Synthesis?
Require a personalized glycopeptide or peptide sequence, or specific modifications? Explore our tailored synthesis services, precisely designed to meet your unique requirements.